General Information

  • ID:  hor005903
  • Uniprot ID:  A5A6J6(199-211)
  • Protein name:  C-terminal peptide
  • Gene name:  SCG5
  • Organism:  Pan troglodytes (Chimpanzee)
  • Family:  7B2 family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Pan (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0030234 enzyme regulator activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0046883 regulation of hormone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0030141 secretory granule

Sequence Information

  • Sequence:  SVPHFSDEDKDPE
  • Length:  13(199-211)
  • Propeptide:  MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE
  • Signal peptide:  MVSRMVSTMLSGLLFWLASGWTPAFA
  • Modification:  T6 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathw
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PCSK2
  • Target Unid:  H2QJI6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A5A6J6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005903_AF2.pdbhor005903_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 171574 Formula: C64H92N16O26
Absent amino acids: ACGILMNQRTWY Common amino acids: D
pI: 3.92 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -172.31 Boman Index: -4977
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 22.31
Instability Index: 3772.31 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17574350
  • Title:  Mapping of chimpanzee full-length cDNAs onto the human genome unveils large potential divergence of the transcriptome.